PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Itr_sc000464.1_g00016.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Convolvulaceae; Ipomoeeae; Ipomoea
Family GRAS
Protein Properties Length: 574aa    MW: 63759.9 Da    PI: 4.9721
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Itr_sc000464.1_g00016.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS442.13.8e-1352055742374
                     GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsev 87 
                              ++lL++cA a+++g+le+a+a++++l++++s +g+p  R+aay++eALaar+  s+++lykal++++ +   s ++l+a+++++ev
  Itr_sc000464.1_g00016.1 205 KQLLFSCAAAIQHGNLEQASAMINELRQMVSIQGEPSDRIAAYMVEALAARMDTSGKGLYKALKCKAPP---SNDRLSAMQVLFEV 287
                              589*****************************************************************9...9************* PP

                     GRAS  88 sPilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAee 171
                              +P+++f++++aN aIlea+ ge+ v iiDfdi+qG Q+ +Llq+Las p++pp+lR+Tg+++pes+   +  l+ +g rL+k+Ae 
  Itr_sc000464.1_g00016.1 288 CPCFRFGFMAANGAILEALMGEKNVNIIDFDINQGSQYYTLLQTLASMPGKPPHLRLTGIDDPESVqrPTGGLRLIGLRLEKLAED 373
                              ****************************************************************99889999************** PP

                     GRAS 172 lgvpfefnvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerf 257
                              l++pfef++ +  + + + + +L ++pgE+++Vn+++qlh+++desvs+ ++rd++L++vksl+Pk+v+vveq++++n+++Fl rf
  Itr_sc000464.1_g00016.1 374 LKLPFEFRA-MPAESALVAPTMLGCQPGETVIVNFAFQLHHMPDESVSTVNQRDQLLRMVKSLNPKLVTVVEQDVNTNTAPFLPRF 458
                              *********.79999*********************************************************************** PP

                     GRAS 258 lealeyysalfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrk 343
                              +ea +yysa+f+sl+a+lpr+s+er++vEr++l+r+i n++aceg+er+er e ++kWr+r+++aGF++ p+s +++++++ l+++
  Itr_sc000464.1_g00016.1 459 AEAYNYYSAVFESLDATLPRDSQERMNVERHCLARDIINIIACEGEERIERYEVAGKWRARMMMAGFNSCPISRNVNDSIRKLIKQ 544
                              ************************************************************************************** PP

                     GRAS 344 vksdgyrveeesgslvlgWkdrpLvsvSaWr 374
                              ++++ y+v+e+ gsl +gW+d+ L+++SaWr
  Itr_sc000464.1_g00016.1 545 YSER-YKVKEDAGSLHFGWEDKILIVASAWR 574
                              **66.*************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098565.167178555IPR005202Transcription factor GRAS
PfamPF035141.3E-132205574IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 574 aa     Download sequence    Send to blast
MSLVRSSTPF GNRKLYLLNG HGDSSTGLST SMFNPEKHEI AYAAESYSSG SYDANYFLDS  60
PSPSSDLVHP SASEALVNAF QHCPPPCPVS SGENSLSSIQ SLRKCGTYQV NYDSEYISSQ  120
SPDPLDFEEG NVRLKLQELE RALLDDNDDD AMFGCTQSME VDGQWADPIC SLFQNDSPKE  180
SSSSESNVST RSSNKVDTHT HQTPKQLLFS CAAAIQHGNL EQASAMINEL RQMVSIQGEP  240
SDRIAAYMVE ALAARMDTSG KGLYKALKCK APPSNDRLSA MQVLFEVCPC FRFGFMAANG  300
AILEALMGEK NVNIIDFDIN QGSQYYTLLQ TLASMPGKPP HLRLTGIDDP ESVQRPTGGL  360
RLIGLRLEKL AEDLKLPFEF RAMPAESALV APTMLGCQPG ETVIVNFAFQ LHHMPDESVS  420
TVNQRDQLLR MVKSLNPKLV TVVEQDVNTN TAPFLPRFAE AYNYYSAVFE SLDATLPRDS  480
QERMNVERHC LARDIINIIA CEGEERIERY EVAGKWRARM MMAGFNSCPI SRNVNDSIRK  540
LIKQYSERYK VKEDAGSLHF GWEDKILIVA SAWR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A4e-582065746375GRAS family transcription factor containing p
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009766066.10.0PREDICTED: scarecrow-like protein 1
RefseqXP_009766065.10.0PREDICTED: scarecrow-like protein 1
RefseqXP_009766064.10.0PREDICTED: scarecrow-like protein 1
RefseqXP_009766062.10.0PREDICTED: scarecrow-like protein 1
RefseqXP_009766061.10.0PREDICTED: scarecrow-like protein 1
RefseqXP_016474713.10.0PREDICTED: scarecrow-like protein 1
RefseqXP_016474710.10.0PREDICTED: scarecrow-like protein 1
RefseqXP_016474704.10.0PREDICTED: scarecrow-like protein 1
RefseqXP_016474696.10.0PREDICTED: scarecrow-like protein 1
RefseqXP_016474687.10.0PREDICTED: scarecrow-like protein 1
RefseqXP_016474681.10.0PREDICTED: scarecrow-like protein 1
SwissprotQ9SDQ30.0SCL1_ARATH; Scarecrow-like protein 1
TrEMBLQ00LP30.0Q00LP3_SOLLC; GRAS6
STRINGSolyc04g064550.1.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA89672429
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G21450.10.0SCARECROW-like 1